PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C019117P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 302aa    MW: 32468.4 Da    PI: 6.9128
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C019117P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.71.7e-3097150155
         G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  MELO3C019117P1  97 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 150
                     59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.87E-2094154IPR009057Homeodomain-like
PROSITE profilePS5129411.05994153IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-3096155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.2E-2498150IPR006447Myb domain, plants
PfamPF002491.1E-7100149IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MREEHSNWFS RWEEELPSPD ELMPLSQTLI TPDLALAFDI QNPSNSSPPL PCPSPPLSNP  60
LPGSGNGIVP PNSADFGDSA DLGSGAASDE PARTLKRPRL VWTPQLHKRF VDAVAHLGIK  120
NAVPKTIMQL MSVDGLTREN VASHLQKYRL YLKRMQGLSG GGAGGGAALV GSSDPATDHL  180
FASSPVPPHL LHSARTSSDH FLPFVPMATL QQHHHHQQQM AAAAAVAGHT QLQPPYHRQV  240
GHFGSPPNGQ FEHPFLARQS QPIHRMGTSV HNSVPNYIED LESANATGGR KVLTLFPTGD  300
D*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-2096155463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818780.0LN681878.1 Cucumis melo genomic scaffold, anchoredscaffold00036.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008455739.10.0PREDICTED: transcription factor PCL1-like
TrEMBLA0A0A0L0V30.0A0A0A0L0V3_CUCSA; Uncharacterized protein
STRINGVIT_08s0040g00900.t011e-125(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.15e-93G2-like family protein